Anti-Dscam antibody
| Name | Anti-Dscam antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85362 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 1547-1596 ( MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV ) of Human Dscam (NP_001380) |
| Description | Rabbit Polyclonal |
| Gene | DSCAM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Dscam antibody (ab85362) at 1 µg/ml + 10 µg HepG2 cell lysateSecondaryHRP conjugated anti-Rabbit IgG diluted 1/50,000.