Anti-DUSP19 antibody
| Name | Anti-DUSP19 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab118720 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 ( MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG ) of Rat DUSP19 (NP_001101209) |
| Description | Rabbit Polyclonal |
| Gene | DUSP19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DUSP19 antibody (ab118720) at 1 µg/ml + Rat Muscle lysate at 10 µg