Name | Anti-DUSP19 antibody |
---|---|
Supplier | Abcam |
Catalog | ab118720 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Human, Pig |
Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 ( MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG ) of Rat DUSP19 (NP_001101209) |
Description | Rabbit Polyclonal |
Gene | DUSP19 |
Conjugate | Unconjugated |
Supplier Page | Shop |