Anti-DUXA antibody
| Name | Anti-DUXA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99058 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 154-203 (SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGAR T) of Human DUXA (NP_001012747) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | DUXA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DUXA antibody (ab99058) at 1 µg/ml + Human fetal stomach lysate at 10 µg