Anti-Dynein axonemal intermediate chain 1 antibody
| Name | Anti-Dynein axonemal intermediate chain 1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81507 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 108-157 ( EAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVD ) of Human Dynein axonemal intermediate chain 1 (NP_004402) |
| Description | Rabbit Polyclonal |
| Gene | DYNC1I1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Dynein axonemal intermediate chain 1 antibody (ab81507) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution