Name | Anti-EFHA2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab89869 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Bovine, Cat, Pig |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72-121 ( AAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPV ) of Human EFHA2 (NP_859074) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | MICU3 |
Conjugate | Unconjugated |
Supplier Page | Shop |