Anti-EFHA2 antibody
| Name | Anti-EFHA2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89869 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72-121 ( AAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPV ) of Human EFHA2 (NP_859074) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MICU3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EFHA2 antibody (ab89869) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution