Anti-EID1 antibody [26]
| Name | Anti-EID1 antibody [26] |
|---|---|
| Supplier | Abcam |
| Catalog | ab78323 |
| Prices | $406.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | 26 |
| Applications | ICC/IF ICC/IF ELISA WB |
| Species Reactivities | Mouse, Rat, Human, Bovine, Monkey, Orangutan |
| Antigen | Synthetic peptide: YEKTPFDQLAFIEELFSLMVVNRLTEELGC , corresponding to amino acids 159 - 187 of Human EID1 Run BLAST with Run BLAST with |
| Description | Mouse Monoclonal |
| Gene | EID1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab78323 staining EID1 in HeLA cells by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with 4% paraformaldehyde, permeabilized with Triton X-100 0.25% in PBS and blocked with 1.5% BSA for 30 minutes. Samples were incubated with primary antibody (1/100 in PBS + 1% BSA) overnight at 4°C. An Alexa Fluor®488-conjugated Goat anti-mouse IgG polyclonal (1/1000 in PBS + 1% BSA) was used as the secondary antibody incubated for 1 hour. DAPI was used to stain the nuclear DNA.
![All lanes : Anti-EID1 antibody [26] (ab78323) at 1 µg/mlLane 1 : extracts from MCF7 cells transfected with control vector pCMV1Lane 2 : extracts from MCF7 cells transfected with the EID1 expression vector pcDNA3/EID1 SecondaryHRP-conjugated mouse IgG](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_2/12446_EID1-Primary-antibodies-ab78323-7.JPG)
All lanes : Anti-EID1 antibody [26] (ab78323) at 1 µg/mlLane 1 : extracts from MCF7 cells transfected with control vector pCMV1Lane 2 : extracts from MCF7 cells transfected with the EID1 expression vector pcDNA3/EID1 SecondaryHRP-conjugated mouse IgG