Anti-EIF4E1B antibody - N-terminal
| Name | Anti-EIF4E1B antibody - N-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab136318 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 20-69 ( EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA ) of Human EIF4E1B (NM_001099408) |
| Description | Rabbit Polyclonal |
| Gene | EIF4E1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EIF4E1B antibody - N-terminal (ab136318) at 1 µg/ml + Human fetal heart lysate at 10 µgSecondarystandard HRP-labelled anti-rabbit