Anti-ENTPD2 antibody
| Name | Anti-ENTPD2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102651 |
| Prices | $370.00 |
| Sizes | 400 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 92 - 122 ( ASQSLVGCLEQALQDVPKERHAGTPLYLGAT ) of Human ENTPD2 (Q9Y5L3), conjugated to KLH |
| Description | Rabbit Polyclonal |
| Gene | ENTPD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
