Anti-epsilon Tubulin antibody
| Name | Anti-epsilon Tubulin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98833 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 179-228 ( PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG ) of Human epsilon Tubulin (NP_057346) |
| Description | Rabbit Polyclonal |
| Gene | TUBE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-epsilon Tubulin antibody (ab98833) at 1 µg/ml + MCF7 cell lysate at 10 µg