Name | Anti-ERAS antibody |
---|---|
Supplier | Abcam |
Catalog | ab89867 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide correspopnding to a region within the internal sequence amiono acids 144-193 (QPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF S) of Human ERAS (NP_853510) |
Description | Rabbit Polyclonal |
Gene | ERAS |
Conjugate | Unconjugated |
Supplier Page | Shop |