Anti-ERAS antibody
| Name | Anti-ERAS antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89867 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide correspopnding to a region within the internal sequence amiono acids 144-193 (QPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF S) of Human ERAS (NP_853510) |
| Description | Rabbit Polyclonal |
| Gene | ERAS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ERAS antibody (ab89867) at 1 µg/ml + Fetal lung lysate (Human) at 10 µg