Anti-eRF3B/GSPT2 antibody
| Name | Anti-eRF3B/GSPT2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84180 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 143-192 (MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSV I) of Human eRF3B/GSPT2 (NP_060564) |
| Description | Rabbit Polyclonal |
| Gene | GSPT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-eRF3B/GSPT2 antibody (ab84180) at 1 µg/ml + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution