Anti-EVA1 antibody
| Name | Anti-EVA1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98877 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | synthetic peptide corresponding to a region within N terminal amino acids 35-84 (LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDP F) of Human EVA1 (NP_005788) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MPZL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EVA1 antibody (ab98877) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg