Anti-EVER2 antibody
| Name | Anti-EVER2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102583 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 143-192, PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG , of Human TMC8 (NP_689681) |
| Description | Rabbit Polyclonal |
| Gene | TMC8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EVER2 antibody (ab102583) at 1 µg/ml + 721B cell lysate at 10 µg