Name | Anti-EXOC3L2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab135339 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 206-255 (GAQALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSR V) of Human EXOC3L2 (NP_612635) |
Description | Rabbit Polyclonal |
Gene | EXOC3L2 |
Conjugate | Unconjugated |
Supplier Page | Shop |