Anti-EXOC3L2 antibody
| Name | Anti-EXOC3L2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab135339 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 206-255 (GAQALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSR V) of Human EXOC3L2 (NP_612635) |
| Description | Rabbit Polyclonal |
| Gene | EXOC3L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EXOC3L2 antibody (ab135339) at 1 µg/ml + Human fetal lung lysate at 10 µg