Anti-EY Cadherin antibody
| Name | Anti-EY Cadherin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81343 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 143-192 (NDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTV L) of Human EY Cadherin (NP_071923) |
| Description | Rabbit Polyclonal |
| Gene | CDH24 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EY Cadherin antibody (ab81343) at 1 µg/ml + Human placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution