Anti-FAAH2 antibody
| Name | Anti-FAAH2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81510 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: CLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKELVDMLGDDG , corresponding to a region within C terminal amino acids 397-446 of Human FAAH2 (NP_777572) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FAAH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAAH2 antibody (ab81510) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution