Anti-Factor XIII antibody
| Name | Anti-Factor XIII antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83895 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 (LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPES P) of Human Factor XIII (NP_001985) |
| Description | Rabbit Polyclonal |
| Gene | F13B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Factor XIII antibody (ab83895) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution