Anti-FAM114A2 antibody
| Name | Anti-FAM114A2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122965 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 432-481 (GVREKADVLNPVITAVFLEASNSASYIQDAFQLLLPVLQISLIESKTES S) of Mouse FAM114A2 (NP_080618) |
| Description | Rabbit Polyclonal |
| Gene | FAM114A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM114A2 antibody (ab122965) at 1 µg/ml + Mouse pancreas lysate at 10 µg