Name | Anti-FAM134A antibody |
---|---|
Supplier | Abcam |
Catalog | ab98244 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 143-192 ( AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS ) of Human FAM143A (NP_077269) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | FAM134A |
Conjugate | Unconjugated |
Supplier Page | Shop |