Anti-FAM134A antibody
| Name | Anti-FAM134A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98244 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 143-192 ( AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS ) of Human FAM143A (NP_077269) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FAM134A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM134A antibody (ab98244) at 1 µg/ml + HT1080 cell lysate at 10 µg