Anti-FAM161B antibody
| Name | Anti-FAM161B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90125 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 504 - 553 ( MDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQV ) of Human FAM161B (NP_689658) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FAM161B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM161B antibody (ab90125) at 1 µg/ml + THP1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution