Name | Anti-FAM161B antibody |
---|---|
Supplier | Abcam |
Catalog | ab90125 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 504 - 553 ( MDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQV ) of Human FAM161B (NP_689658) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | FAM161B |
Conjugate | Unconjugated |
Supplier Page | Shop |