Anti-FAM171A1 antibody
| Name | Anti-FAM171A1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83777 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Rabbit, Guinea Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 468-517 ( ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE ) of Human FAM171A1 (NP_001010924) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FAM171A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM171A1 antibody (ab83777) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution