Anti-FAM173B antibody
| Name | Anti-FAM173B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81219 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 ( EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV ) of human FAM173B (NP_954584) |
| Description | Rabbit Polyclonal |
| Gene | FAM173B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM173B antibody (ab81219) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal lung lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution