Anti-FAM19A4 antibody
| Name | Anti-FAM19A4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133927 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Human, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 42-91 ( VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA ) of rat FAM19A4 (NP_001128172) |
| Description | Rabbit Polyclonal |
| Gene | FAM19A4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM19A4 antibody (ab133927) at 1 µg/ml + rat kidney lysate at 10 µg