Anti-Fam212b antibody
| Name | Anti-Fam212b antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128263 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 161-210 ( DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA ) of Rat Fam212b (NP_001101183) |
| Description | Rabbit Polyclonal |
| Gene | FAM212B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Fam212b antibody (ab128263) at 1 µg/ml + Rat brain lysate at 10 µg