Anti-FAM54A antibody
| Name | Anti-FAM54A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105816 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 254 - 303 ( NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ ) of Human FAM54A (NP_001092756) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MTFR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM54A antibody (ab105816) at 1 µg/ml + fetal muscle lysate at 10 µg/ml