Anti-FAM70A antibody
| Name | Anti-FAM70A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82866 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 ( IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR ) of Human FAM70A (NP_060408) |
| Description | Rabbit Polyclonal |
| Gene | TMEM255A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM70A antibody (ab82866) at 1 µg/ml (5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution