Name | Anti-FAM70A antibody |
---|---|
Supplier | Abcam |
Catalog | ab82866 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | ELISA WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 ( IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR ) of Human FAM70A (NP_060408) |
Description | Rabbit Polyclonal |
Gene | TMEM255A |
Conjugate | Unconjugated |
Supplier Page | Shop |