Anti-FAM71D antibody
| Name | Anti-FAM71D antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90262 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Guinea Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 288-337 ( TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISNI ) of Human FAM71D (NP_775797) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FAM71D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM71D antibody (ab90262) at 1 µg/ml + Human fetal kidney lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution