Name | Anti-FAM71D antibody |
---|---|
Supplier | Abcam |
Catalog | ab90262 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Guinea Pig |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 288-337 ( TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISNI ) of Human FAM71D (NP_775797) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | FAM71D |
Conjugate | Unconjugated |
Supplier Page | Shop |