Anti-FAM78A antibody
| Name | Anti-FAM78A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108175 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 211-260 (WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNA N) of Human FAM78A (NM_033387) |
| Description | Rabbit Polyclonal |
| Gene | FAM78A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FAM78A antibody (ab108175) at 0.5 µg/ml + Transfected 293T lysate at 10 µg