Name | Anti-FAM82A1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84351 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 431 - 480 (RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEE P) of Human FAM82A1 (NP_653314) |
Description | Rabbit Polyclonal |
Gene | RMDN2 |
Conjugate | Unconjugated |
Supplier Page | Shop |