Anti-FBXL16 antibody
| Name | Anti-FBXL16 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87778 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal aa 432-481 (CPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE) of Human FBXL16 (NP_699181) |
| Description | Rabbit Polyclonal |
| Gene | FBXL16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FBXL16 antibody (ab87778) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution