Anti-FBXO36 antibody
| Name | Anti-FBXO36 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81317 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 37-86 ( WKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINLC ) of Human FBXO36 (NP_777559) |
| Blocking Peptide | FBXO36 peptide |
| Description | Rabbit Polyclonal |
| Gene | FBXO36 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FBXO36 antibody (ab81317) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution