Anti-FCN1 antibody
| Name | Anti-FCN1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108284 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 215-264 ( HQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDND ) of Human FCN1 (NP_001994) |
| Description | Rabbit Polyclonal |
| Gene | FCN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FCN1 antibody (ab108284) at 1 µg/ml + Human Placenta Lysate at 10 µg