Anti-FLAD1 antibody
| Name | Anti-FLAD1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89968 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 108-157 (GRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV A) of Human FLAD1 (NP_079483) |
| Description | Rabbit Polyclonal |
| Gene | FLAD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FLAD1 antibody (ab89968) at 1 µg/ml + PANC1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution