Anti-FPGT antibody
| Name | Anti-FPGT antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133866 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 344-393 ( TSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIP ) of Human FPGT (NP_003829) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FPGT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FPGT antibody (ab133866) at 1 µg/ml + ACHN cell lysate at 10 µg