Anti-FRZB antibody
| Name | Anti-FRZB antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108169 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 216-265 (VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEER S) of Human FRZB (NP_001454) |
| Description | Rabbit Polyclonal |
| Gene | FRZB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
