Name | Anti-FRZB antibody |
---|---|
Supplier | Abcam |
Catalog | ab108169 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 216-265 (VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEER S) of Human FRZB (NP_001454) |
Description | Rabbit Polyclonal |
Gene | FRZB |
Conjugate | Unconjugated |
Supplier Page | Shop |