Anti-FUT8 antibody
| Name | Anti-FUT8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab115925 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 27-76 ( LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR ) of Human FUT8 (NP_004471) |
| Description | Rabbit Polyclonal |
| Gene | FUT8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FUT8 antibody (ab115925) at 1 µg/ml + Human fetal liver lysate at 10 µg