Name | Anti-FUT8 antibody |
---|---|
Supplier | Abcam |
Catalog | ab115925 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 27-76 ( LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR ) of Human FUT8 (NP_004471) |
Description | Rabbit Polyclonal |
Gene | FUT8 |
Conjugate | Unconjugated |
Supplier Page | Shop |