Anti-GABA B Receptor 2 antibody
| Name | Anti-GABA B Receptor 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab115929 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 761-810 ( QFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLE ) of Human GABBR2 (NP_005449) |
| Description | Rabbit Polyclonal |
| Gene | GABBR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GABA B Receptor 2 antibody (ab115929) at 1 µg/ml + HeLa cell lysate at 10 µg