Anti-GABA B Receptor 2 antibody

Name Anti-GABA B Receptor 2 antibody
Supplier Abcam
Catalog ab115929
Prices $376.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish
Antigen Synthetic peptide corresponding to a region within C terminal amino acids 761-810 ( QFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLE ) of Human GABBR2 (NP_005449)
Description Rabbit Polyclonal
Gene GABBR2
Conjugate Unconjugated
Supplier Page Shop

Product images