Anti-GADL1 antibody
| Name | Anti-GADL1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122637 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Mouse, Rat, Human |
| Antigen | antigen sequence: CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPF LVC, corresponding to amino acids 218-270 of Human GADL1 (Isoform 1) |
| Description | Rabbit Polyclonal |
| Gene | GADL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-GADL1 antibody (ab122637) at 1/250 dilutionLane 1 : RT 4 cell line lysateLane 2 : U 251 MG cell line lysateLane 3 : Human plasmaLane 4 : Human liver tissue lysateLane 5 : Human tonsil tissue lysate
ab122637, at 1/200, staining GADL1 in paraffin embedded Human rectum by Immunohistochemistry.