Anti-GALE antibody
| Name | Anti-GALE antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108173 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 201-250 (PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAK G) of Human GALE (NP_001008217) |
| Description | Rabbit Polyclonal |
| Gene | GALE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GALE antibody (ab108173) at 0.5 µg/ml + 293T cell lysate at 10 µg