MLH3 antibody

Name MLH3 antibody
Supplier Fitzgerald
Catalog 70R-5576
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MLH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP
Purity/Format Affinity purified
Blocking Peptide MLH3 Blocking Peptide
Description Rabbit polyclonal MLH3 antibody
Gene MLH3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.