| Name | GBAS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1987 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GBAS antibody was raised using the middle region of GBAS corresponding to a region with amino acids VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIG |
| Purity/Format | Affinity purified |
| Blocking Peptide | GBAS Blocking Peptide |
| Description | Rabbit polyclonal GBAS antibody raised against the middle region of GBAS |
| Gene | GBAS |
| Supplier Page | Shop |