Name | FAM98B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4262 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI |
Purity/Format | Affinity purified |
Blocking Peptide | FAM98B Blocking Peptide |
Description | Rabbit polyclonal FAM98B antibody raised against the N terminal of FAM98B |
Gene | FAM98B |
Supplier Page | Shop |