HNRPA1 antibody

Name HNRPA1 antibody
Supplier Fitzgerald
Catalog 70R-1313
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG
Purity/Format Total IgG Protein A purified
Blocking Peptide HNRPA1 Blocking Peptide
Description Rabbit polyclonal HNRPA1 antibody raised against the C terminal of HNRPA1
Gene HNRNPA1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.