| Name | WDR6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2628 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse |
| Antigen | WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | WDR6 Blocking Peptide |
| Description | Rabbit polyclonal WDR6 antibody raised against the C terminal of WDR6 |
| Gene | WDR6 |
| Supplier Page | Shop |