Name | FAM113A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4107 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM113A antibody was raised using the C terminal of FAM113A corresponding to a region with amino acids YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG |
Purity/Format | Affinity purified |
Blocking Peptide | FAM113A Blocking Peptide |
Description | Rabbit polyclonal FAM113A antibody raised against the C terminal of FAM113A |
Gene | PCED1A |
Supplier Page | Shop |