| Name | SULT1C2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2216 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SULT1C2 antibody was raised using the C terminal of SULT1C2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SULT1C2 Blocking Peptide |
| Description | Rabbit polyclonal SULT1C2 antibody raised against the C terminal of SULT1C2 |
| Gene | SULT1C2 |
| Supplier Page | Shop |