| Name | UCK2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3434 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY |
| Purity/Format | Affinity purified |
| Blocking Peptide | UCK2 Blocking Peptide |
| Description | Rabbit polyclonal UCK2 antibody raised against the N terminal of UCK2 |
| Gene | UCK2 |
| Supplier Page | Shop |