| Name | SDS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3627 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SDS Blocking Peptide |
| Description | Rabbit polyclonal SDS antibody raised against the N terminal of SDS |
| Gene | SDHB |
| Supplier Page | Shop |