| Name | STATH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5453 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | STATH antibody was raised using the middle region of STATH corresponding to a region with amino acids MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP |
| Purity/Format | Affinity purified |
| Blocking Peptide | STATH Blocking Peptide |
| Description | Rabbit polyclonal STATH antibody raised against the middle region of STATH |
| Gene | STATH |
| Supplier Page | Shop |