| Name | RNF207 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2537 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF207 Blocking Peptide |
| Description | Rabbit polyclonal RNF207 antibody raised against the N terminal of RNF207 |
| Gene | RNF207 |
| Supplier Page | Shop |